PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017403
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 337aa    MW: 36768.2 Da    PI: 7.0718
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-30974PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.8e-383895461
     zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               +alkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  Lsa017403 38 QALKCPRCESLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 95
               789****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.3E-333894IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-293994IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4884094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MQDIHSIGSG GGGGRLFGGG GGDRRLRPHH HHQGHGPQAL KCPRCESLNT KFCYYNNYNL  60
SQPRHFCKSC RRYWTKGGVL RNVPVGGGCR KTKRSKPKSS NNNPSSDATV RKSSHSQNSS  120
SDSSSLTANT TTAKTKVKTT PIAPAAAAEV LSGIKSTNSA PTLLNFQESS SGFLNITQSS  180
APNPSFDPQL LNHSSAENNI FPEIGTFTSL ITSSTGQLPL GFNIAADISP FRMHHTGHLV  240
ENSNANQQQW MHTDHTMEDD LKVPDTGPLG FMDAHTDQTE FSGLHDKATN DELGTEDWDN  300
GTDQALFDLT GSVDQSYWSQ TQWDEHDHGH HQLNYLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11220GGRLFGGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267092.11e-81PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A103XYQ41e-125A0A103XYQ4_CYNCS; Zinc finger, Dof-type
STRINGVIT_17s0000g04850.t013e-77(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.19e-35OBF binding protein 4